<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
60 07p60-8 Germany 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 52
2 3TC+D4T 35
3 3TC+D4T+NFV+NVP 24
4 3TC+AZT+DDI+SQV 37
5 ABC+D4T+EFV+IDV 96
6 None 296
7 FTC+RTV+TDF+TPV 10
8 FTC+RTV+TPV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219D Y188L G190GR K11R, T39A, K102M, V106I, V118I, K122E, K173N, V179I, E203Q, Q207D, R211K, D218E, L228H, A272P, K277R, L283I, R284K, I293V, E297EK L303H, A304Y
>07p60-8| codons 1-335
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNQNPDIII
YQYVDDLLVRSDLEIGQHRTKIQELRDHLWKWGFYTPEDKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIKGTKALTEVVPLTKEAE
LEHYENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82L   L10I, K20IM, K45Q, I62V, L63P, A71V, V77I, I93L G94GD
>07p60-8| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEMNLPGRWKPQIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPLNIIGRNLLTQLDCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008