<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
60 02p60-4 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 52
2 3TC+D4T 35
3 3TC+D4T+NFV+NVP 24
4 3TC+AZT+DDI+SQV 37
5 ABC+D4T+EFV+IDV 96
6 None 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y K219N Y188L   K11R, T39A, V106VI, V118VI, K122E, I135IV, K173N, E203EKQ, Q207D, R211K, D218DE, L228H, A272P, K277R, L283I, R284RK, I293V, P294Q, E297A  
>02p60-4| codons 1-333
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIQELRDHLWKWGFYTPENKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIKGTKALTEVVQLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, R41RK, K43KR, I62V, L63P, A71AV, V77I, I93L L89LQ
>02p60-4| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNQLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008