<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2095 CA13973 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 AZT+ DDI 21
3 AZT+ DDC+ SQV 22
4 AZT+ DDC+ RTV 25
5 3TC+ AZT+ IDV 31
6 3TC+ AZT+ NVP 1
7 3TC+AZT+RTV+SQV 58
8 D4T+DDI+EFV+Unknown 34
9 APV+D4T+DDC+EFV+SQV 6
10 APV+D4T+DDI+EFV+NFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AT, L90M L23LIR, L33F, F53L I13IL, K20R, E35D, M36I, N37S, R41K, D60E, I62V, L63P, A71V D25D*EY
>CA13973| codons 11-99
VTLKIGGQLREARLYTGADDTVFEDISLPGKWKPKMIGGIGGLVKVRQYEQVPIEICGHK
VIGTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   G190S K101H K43Q, V118I, K122E, K281R, A288S  
>CA13908| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKSLTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005