<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
59 01p59-3 Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 489
2 3TC+AZT+SQV 29
3 D4T+NFV+SQV 10
4 None 22
5 3TC+D4T 1
6 3TC+AZT+D4T 4
7 3TC+AZT+D4T+IDV 8
8 3TC+AZT+IDV 27
9 3TC+AZT+IDV 19
10 D4T+DDI+EFV 34
11 D4T 7
12 3TC+ABC+D4T 2
13 3TC+ABC+D4T+LPV 68
14 3TC+ABC+LPV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73S L10I, K14R, I15V, N37E, L63P, A71V, V77VI  
>01p59-3| codons 1-99
PQITLWQRPIVTIRVGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVISTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N   P4PS, T39A, K122E, D123N, I135T, I142V, S162C, V245T, K277R, T286A, A288S, I293V, E297K  
>01p59-3| codons 1-324
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008