<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
59 00p59-2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 489
2 3TC+AZT+SQV 29
3 D4T+NFV+SQV 10
4 None 22
5 3TC+D4T 1
6 3TC+AZT+D4T 4
7 3TC+AZT+D4T+IDV 8
8 3TC+AZT+IDV 27
9 3TC+AZT+IDV 19
10 D4T+DDI+EFV 34
11 D4T 7
12 3TC+ABC+D4T 2
13 3TC+ABC+D4T+LPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, K14R, I15V, R41K, L63P, K70R, A71V, I72T, I93IL  
>00p59-2| codons 1-99
PQITLWQRPIVTIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHRVTGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008