<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
59 99p59-1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 489
2 3TC+AZT+SQV 29
3 D4T+NFV+SQV 10
4 None 22
5 3TC+D4T 1
6 3TC+AZT+D4T 4
7 3TC+AZT+D4T+IDV 8
8 3TC+AZT+IDV 27
9 3TC+AZT+IDV 19
10 D4T+DDI+EFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T, L90M G73S K14R, I15V, N37E, L63P, A71V, I72L  
>99p59-1| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N   T39A, K122E, I135T, I142V, S162C, V245T, K277R, R284K, T286A, A288S, I293V, E297K  
>99p59-1| codons 1-316
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKSLTEVVPLTKEAE
LELAENREILKEPVHG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008