<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
54 09p54-2 France 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 230
2 3TC+D4T+SQV 9
3 3TC+D4T+NFV 35
4 DDI+IDV+RTV 31
5 DDI+IDV+NVP+RTV 38
6 3TC+ABC+EFV 19
7 3TC+ABC+D4T+EFV 56
8 3TC+ABC+AZT+EFV 23
9 EFV 11
10 3TC+D4T+LPV+SQV+TDF 112
11 3TC+LPV+SQV+TDF 186
12 FTC+LPV+SQV+TDF 99

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, N37S, L63A  
>09p54-2| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, I202V, Q207E, A272P, S322T, I329V, Q334E N306ND
>09p54-2| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAEDREILKEPVHGVYYDPTKDLIAEVQKQGEG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008