<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
54 99p54-1 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 230
2 3TC+D4T+SQV 9
3 3TC+D4T+NFV 35
4 DDI+IDV+RTV 31
5 DDI+IDV+NVP+RTV 38
6 3TC+ABC+EFV 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219KE Y181C, G190S   V8I, K43E, K101Q, V118I, K122E, V179I, I202V, E203K, Q207E, A272P, Q278QH, T286A E40E*
>99p54-1| codons 1-324
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICT*LEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVSSDLEIGQHRTKVKELREHLWRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, N37S, L63P  
>99p54-1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008