<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4767 CA13969 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+SQV 48
3 3TC+AZT+IDV 78
4 3TC+AZT+NFV 67
5 3TC+AZT+EFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37E, L63A, I72IV, V77I, I93L  
>CA13969| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K20KR, V35T, V60I, A98AS, K102Q, K122P, I135IL, K166R, D177E, I178IM, T200A, E248DN  
>CA13904| codons 1-254
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKQNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTV

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005