<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
53 04p53-1 Germany 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 129
2 3TC+D4T+SQV 174
3 None 2
4 DDI+EFV+LPV 193

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215F   K103N, G190A   S68G, V90I, K122E, I135T, D177E, T200A, Q207E, A272P, T286V, A288S, I293V  
>04p53-1| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELREHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGVKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I62V, L63P, A71V, V77I, I93L  
>04p53-1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008