<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
52 00p52-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDC 89
3 None 16
4 D4T+DDI 154
5 3TC+ABC+AZT 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R V75T, K219Q     V35I, K43Q, K64Y, K102KR, K103R, V118I, L210F, F214L, D218DE, L228H, K277R, T286A, A288T, I293V  
>00p52-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEQEGKISKIGPENPYNTPV
FAIYKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKRRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLFRWGLTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKTLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, K43R, R57RK, L63PT, I64V, E65D  
>00p52-1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWRPKMIGGIGGFIKVKQYD
QITVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008