<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
50 00p50-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 2
2 None 115
3 3TC+AZT 17
4 3TC+AZT+SQV 9
5 3TC+AZT+RTV 6
6 3TC+AZT 2
7 3TC+AZT+SQV 10
8 D4T+IDV 19
9 None 9
10 D4T+DDI+IDV 1
11 D4T+IDV 3
12 None 22
13 ABC+D4T+IDV+RTV 5
14 D4T+DDI+NFV 102

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   T39A, S68G, V90I, V106I, I135T, T165I, Q174QR, R211G, H221Y, A272P, K277R, L283I, I293V, P294Q, I309L  
>00p50-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKRNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVQLTEEAE
LELAENRELLKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, I62V, L63P, V77I, I93L  
>00p50-1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008