<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48 99p48-1 Turkey 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+DDC 35
3 AZT+DDC+SQV 35
4 3TC+D4T+NFV 50
5 DDI+IDV+NVP 45
6 ABC+APV+D4T+EFV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A K43T L10I, T12S, I13V, K20I, L63P, A71T, T74S, V77I  
>99p48-1| codons 1-99
PQITLWQRPIVSVKIGGQLIEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFVKVRQYD
QIPIEICGHKTIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   Y181C, G190A   P4S, K20R, T27S, V35I, K43E, E44D, A98S, K101Q, V118I, K122E, I135V, S162G, K166R, Q207E, R211K, V245E, A272S, I293V, E312Q K64KQ, R143S
>99p48-1| codons 1-324
PISSIETVPVKLKPGMDGPRVKQWPLSEEKIKALIEICTELEEDGKISKIGPENPYNTPV
FAIQKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGISYQYNVLPQGWKGSPAIFQGSMTRILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKQPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008