<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5622 CA13965 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT+IDV 208

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S I13IV, R41K, I62V, L63P, I66IL, A71AV, I72L, V77I, I93L  
>CA13965| codons 11-99
VTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYDQVPIELCGHK
VLSTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y       I135V, I142V, V179I, E203EG, Q207E, V245T, E248V K154K*, V189VL
>CA13900| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGW*GSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYLGSDLEIGQHRTKIGELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPVKDSWTVNDIQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001