<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
47 02p47-2 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 195
2 AZT+DDC 1
3 AZT+DDC+DDI 92
4 AZT 13
5 3TC+AZT 65
6 3TC+AZT+SQV 82
7 3TC+AZT+SQV 26
8 3TC+AZT+SQV 169
9 3TC+ABC+LPV+TDF 1
10 3TC+ABC+APV+RTV+TDF 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, I84V, L90M V11I, G73S L10I, I13V, I15V, N37D, L63P, A71V, I72M  
>02p47-2| codons 1-99
PQITLWQRPIITVKVGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFMKVRQYD
QIPIEICGHKVMSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219Q     D121Y, K122E, I135T, S162C, D177E, D218E, K277R, T286A, I293V, Q334L  
>02p47-2| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008