<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
47 01p47-1 Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 195
2 AZT+DDC 1
3 AZT+DDC+DDI 92
4 AZT 13
5 3TC+AZT 65
6 3TC+AZT+SQV 82
7 3TC+AZT+SQV 26
8 3TC+AZT+SQV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10LI, I13V, K14KR, I15V, Q18QH, K20KIM, N37D, L63P, A71V  
>01p47-1| codons 1-99
PQITLWQRPIVTVRVGGHLMEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, K70R, M184V, T215TNSY K219Q     T69TN, D121Y, K122E, I135T, S162C, D177E, F214FL, L228LR, A272AS, K277R, T286TA, I293V, E297EA, S322Q  
>01p47-1| codons 1-323
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPQK

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008