<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
46 00p46-1 Zaire 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI 21
2 AZT 58
3 DDC 87
4 3TC+AZT 11
5 3TC+D4T 18
6 3TC+D4T+RTV 27
7 3TC+RTV 15
8 DDI+NVP+RTV+SQV 23
9 None 49
10 ABC+EFV+NFV 38
11 None 10
12 3TC+APV+AZT+RTV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54V, V82M, I84V, L90M L33F, Q58E L10V, T12V, I13IV, K14KR, I15V, K20R, E35D, M36I, N37E, R41K, R57K, L63P, H69K, L89I  
>00p46-1| codons 1-99
PQITLWQRPVVVVRVGGQLREALLDTGADDTVFEDIELPGKWKPKLIGGIGGFVKVKEYD
QIPIEICGKKAIGTVLVGPTPMNVIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LV, M184V, L210W, T215F K219Q K103KN, Y181YC A98G V35T, T39E, K122E, D123DN, K173T, Q174K, G196E, I202V, E203K, Q207E, R211RK, L228H, V245Q, E248D, D250E, T286A, E291D, V292I, I293V, E297A  
>00p46-1| codons 1-323
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
CQYVDDLYVGSDLEIEQHRTKVKELREHLWKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSK

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008