<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
45 07p45-4 Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+LPV 51
2 3TC+ABC+LPV 58
3 3TC+ABC+AZT 37
4 3TC+ABC+AZT+TDF 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35ED, M36I, R41K, H69K, L89M  
>07p45-4| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       I5V, V35T, V90I, K104R, F124L, I135IT, S162Y, K173T, Q174R, D177E, T200A, Q207G, R211K, V245Q, E248N, V276I, L283I, T286A, A288T, E291D, V292I, I293V, P294T, S322G R125E
>07p45-4| codons 1-334
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDLEKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTRNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLIRGAKTLTDIVTLTEEAE
LELAENREILKEPVHGVYYDPGKDLIAEIQKQGQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008