<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
39 08p39-3 Zaire 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 148
2 AZT+DDI 3
3 3TC+AZT+DDI 1
4 3TC+AZT 19
5 3TC+AZT+NVP 29
6 3TC+AZT+RTV 3
7 3TC+AZT+IDV 6
8 3TC+IDV 48
9 None 4
10 3TC+AZT+IDV 27
11 D4T+DDI 1
12 D4T+DDI+EFV 2
13 D4T+EFV 1
14 ABC+D4T+EFV 101
15 3TC+AZT+DDI+LPV 181
16 3TC+ATV+AZT+DDI+RTV 174
17 ATV+FTC+RTV+TDF 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, K45R, L63P, H69K, A71T, L89M  
>08p39-3| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKTIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V T215V, K219Q Y188L   K11T, V35T, T39N, D121H, K122E, A158S, K173S, Q174K, D177E, G196E, Q207A, V245Q, A272G, T286A, E291D, I293V, K311R, E312D  
>08p39-3| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSKNPEIVI
YQYVDDLLVGSDLEIEQHRTKIEELRAHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILRDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008