<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
39 01p39-1 Zaire 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 148
2 AZT+DDI 3
3 3TC+AZT+DDI 1
4 3TC+AZT 19
5 3TC+AZT+NVP 29
6 3TC+AZT+RTV 3
7 3TC+AZT+IDV 6
8 3TC+IDV 48
9 None 4
10 3TC+AZT+IDV 27
11 D4T+DDI 1
12 D4T+DDI+EFV 2
13 D4T+EFV 1
14 ABC+D4T+EFV 101
15 3TC+AZT+DDI+LPV 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K45R, L63LP, H69K, L89M  
>01p39-1| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39N, K49KR, V60I, T69S, D121HY, K122E, A158S, T165TI, K173S, Q174K, D177E, G196E, Q207A, V245Q, A272AG, K281KR, T286A, E291D, I293V, E297EK, K311KR, E312D, D324DE  
>01p39-1| codons 1-324
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMIKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCRLLRGAKALTDVVPLTKEAE
LELAENREILRDPVHGVYYDPSKE

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008