<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
38 99p38-1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 48
2 AZT+DDI 91
3 3TC+AZT 13
4 3TC+AZT+SQV 39
5 3TC+AZT+IDV 4
6 3TC+AZT 13
7 3TC+D4T+NFV 35
8 D4T+RTV+SQV 8
9 ABC+RTV+SQV 4
10 3TC+ABC+NVP 8
11 3TC+ABC+IDV+NVP 5
12 None 9
13 3TC+ABC+EFV 57

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, D67DG, V75I, F77L, F116Y, K219Q K103N, Y181C, G190A   E6EK, T69N, K101KR, K122E, D177E, T200A, I202V, Q207E, F214FL, L228H, A272P  
>99p38-1| codons 1-324
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKGSNKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVASDLEIGQHRAKVEELREHLLRWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   I13V, K20I, M36I, I62V, L63P, I64V, T74S  
>99p38-1| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008