<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
37 04p37-1 Italy 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 46
2 3TC+AZT 9
3 3TC+AZT+SQV 22
4 3TC+D4T+SQV 70
5 3TC+D4T+IDV 26
6 3TC+D4T+IDV+NVP 39
7 DDI+NFV+NVP 1
8 ABC+DDI+NFV+NVP 1
9 None 3
10 APV+DDI+NFV+NVP 26
11 D4T+DDI+NVP 22
12 D4T+DDI 4
13 D4T+DDI+LPV 193

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, I84V   L10I, E34Q, L63P, A71T  
>04p37-1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGHKTIGTVLVGPTPSNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219N Y181C   T39A, K49R, V118I, K122E, V179I, H208Y, R211K, F214L, L228H, V245K, I293V, P313S  
>04p37-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGLYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKESVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008