<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
36 06p36-2 Congo-Brazzaville 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+LPV 155
2 3TC+ABC+AZT 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6D, V35T, T39K, K43E, K49R, D123E, E169D, K173A, Q174K, D177E, T200A, Q207A, R211S, K238R, V245E, A272P, L283I, T286A, E291D, V292I, I293V, E312T, S322A, I326V  
>06p36-2| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPAKDLVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I13A, I15V, G16E, E35D, M36I, R41K, K45R, L63T, H69K, L89M  
>06p36-2| codons 1-99
PQITLWQRPVVIAKVEGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008