<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6439 CA13958 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 26
2 DDC+ AZT+ RTV 138
3 3TC+ SQV+ AZT 13
4 EFV+ DDI+ D4T+ NFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S F53L I15IK, K20R, E35D, M36I, N37D, D60DE, L63P, A71V  
>CA13958| codons 14-99
KKGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGLVKVRQYEQIPIEICGHKVIG
TVLVGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   G190S   I2IV, K101Q, K122E, I178M, E203K, R211S, L260LI, S268SC, A272P K263KT
>CA13898| codons 1-274
PVSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVSSDLEIGQHRTKIKELRQHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKIVGTLNWACQIYPGI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005