<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1466 CA13957 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 217
2 AZT+ DDI 8
3 3TC+ D4T 34
4 3TC+ D4T+ NFV 60
5 EFV+ ADV 18
6 EFV+ ADV+ NFV 13
7 EFV+ RTV+ IDV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73C K20V, N37S, R41K, I62V, L63P, I64V, T74S, V77I, I93IL  
>CA13957| codons 13-99
IKIGGQLVEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFIKVRQYDQVPVEICGHKAI
CSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005