Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1466 | CA13957 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 217 |
| 2 | AZT+ DDI | 8 |
| 3 | 3TC+ D4T | 34 |
| 4 | 3TC+ D4T+ NFV | 60 |
| 5 | EFV+ ADV | 18 |
| 6 | EFV+ ADV+ NFV | 13 |
| 7 | EFV+ RTV+ IDV | 55 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, L90M | G73C | K20V, N37S, R41K, I62V, L63P, I64V, T74S, V77I, I93IL |
| >CA13957| codons 13-99 IKIGGQLVEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFIKVRQYDQVPVEICGHKAI CSVLIGPTPVNIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. | AAC, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |