<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5611 CA13953 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 13
2 AZT+DDC 69
3 D4T 35
4 3TC+D4T 9
5 3TC+D4T+IDV 65
6 3TC+D4T+NFV+NVP 39
7 3TC+AZT+NFV+NVP 22
8 3TC+AZT+NFV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10R, E35D, N37E, L63P, A71T, V77I, Q92K  
>CA13953| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     P4S, V90I, I135T, I178M, R199K, Q207N, R211K D17DV, Y144Y*
>CA13887| codons 1-257
PISSIETVPVKLKPGMVGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIR*QYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHKTKIEELRNHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005