<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
27 05p27-7 Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 AZT+DDC 96
3 3TC+AZT+SQV 45
4 3TC+AZT+SQV 217
5 D4T+NVP+TDF 89
6 None 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210LW, T215CNSY   Y188L   K49R, V60VI, S68G, V90I, D123E, I135T, S162D, Q174A, D177E, V179I, Q207E, R211K, R284RK, V292VI, I293V, P294PA, E297K, D324E  
>05p27-7| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKANPEIII
YQYMDDLLVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEIVALTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10IV, I13V, R41K, L63P, T74S, V77I, I93L  
>05p27-7| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008