<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
25 00p25-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+DDI 78
3 AZT+DDC 64
4 3TC+AZT 102
5 3TC+AZT+NFV 20
6 3TC+AZT 4
7 3TC+AZT+D4T 1
8 D4T 8
9 3TC+D4T+IDV 120

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, T215Y D67G     K20R, V60I, S68G, R83K, D123E, I135V, R211K, V245E, A272P, E297K  
>00p25-1| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   L10R, K55R, L63P, I93L D29A
>00p25-1| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGAADTVLEEMNLPGRWKPKLIGGIGGFIRVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008