<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
24 03p24-2 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 79
2 AZT+DDI 13
3 AZT+DDC 2
4 AZT 102
5 3TC+AZT 39
6 AZT+D4T 17
7 AZT+IDV 26
8 AZT+DDC+IDV 39
9 AZT+DDI+IDV 52
10 3TC+D4T+EFV 144
11 3TC+AZT+LPV+SQV+T20 65
12 3TC+AZT+LPV+SQV 70

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K43R, L63P, Q92K  
>03p24-2| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K43E, S162A, E169D, G196E, Q207E, R211K, K277R, R284K, T286A, I293V, V317A, Q334V  
>03p24-2| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGVG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008