<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
24 00p24-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 79
2 AZT+DDI 13
3 AZT+DDC 2
4 AZT 102
5 3TC+AZT 39
6 AZT+D4T 17
7 AZT+IDV 26
8 AZT+DDC+IDV 39
9 AZT+DDI+IDV 52
10 3TC+D4T+EFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I L10F M36I, K43R, I62V, L63P, G73V, Q92E  
>00p24-1| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTILEEINLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAIVTVLVGPTPVNIIGRNLLTEIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, Q151M, M184V D67G, F77L, F116FY, K219E G190Q   K122E, S162D, Q207K, F214FL, D218DE, K277R, T286A, I293V, E297K D113DA
>00p24-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGAAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVQSDLEIGQHRTKIEELRKHLLRWGLTTPEEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008