<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
23 01p23-1 Unknown 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 54
2 None 13
3 AZT 132
4 None 4
5 AZT 34
6 None 50
7 AZT 2
8 AZT+DDI 5
9 AZT 17
10 AZT+D4T 17
11 3TC+AZT 4
12 3TC+AZT+IDV 13
13 3TC+AZT 7
14 3TC+AZT+SQV 66
15 3TC+AZT+SQV 47
16 3TC+AZT+NVP 8
17 3TC+ABC+AZT+NVP 3
18 3TC+AZT+NVP 95

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219KQ Y188L   K20KR, K64R, T69N, A98S, K122E, Q207E, F214L, A272PS, K277R, L283I, I293V, E297A  
>01p23-1| codons 1-320
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15A, E35D, N37D, I62V, L63P, C67CY, A71V, I93L  
>01p23-1| codons 1-99
PQITLWQRPLVTIKAGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEIYGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008