<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
22 01p22-1 Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 AZT+DDI 26
3 AZT+DDC 52
4 AZT 122
5 AZT+DLV 13
6 3TC+AZT 70
7 3TC+AZT+SQV 112
8 D4T+DDI+EFV 10
9 ABC+D4T+EFV 17
10 ABC+D4T+EFV+IDV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N Y318F K43Q, E44D, R83K, V111I, K122E, I142V, D177G, G196E, E203Q, Q207D, H208Y, R211K, Q278E, I293V, E297K E29K, N57Y
>01p22-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEKKIKALVEICTELEQDGKISKIGPENPYYTPV
FAIKKKNSDKWRKVVDFRELNKKTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIEQHRTKIQELRDYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVFYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, K20I, M36I, R41K, K43R, I62V, L63P, A71V, I72T, T74A, I93L  
>01p22-1| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGHKVTGAVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008