<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
21 00p21-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+DDI 39
3 AZT+DDI+IDV 93
4 3TC+D4T+NFV 46
5 None 4
6 3TC+D4T+EFV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T T12P, L19I, K20I, L63P, C67W, V77I, I93L  
>00p21-1| codons 1-99
PQITLWQRPLVPIKIGGQIIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEIWGHKAITTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W, T215Y       V35IM, S48T, S68G, K122E, I135T, A158S, D218DA, A272P, K277KR, I293V, P294Q  
>00p21-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPAKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008