<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
19 00p19-1 Unknown 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 40
2 DDI 104
3 AZT+DDI 27
4 DDI 52
5 3TC+AZT 31
6 3TC 19
7 3TC+D4T 28
8 3TC+D4T+IDV 35
9 3TC+AZT+SQV 5
10 AZT+DDI+NFV+SQV 10
11 3TC+D4T+RTV+SQV 5
12 D4T+DDI+IDV+SQV 15
13 D4T+DDI+RTV+SQV 5
14 D4T+DDI 1
15 None 15
16 D4T+DDI+RTV 5
17 D4T+DDI+NVP 21
18 ABC+D4T+DDI+EFV 3
19 D4T+DDI+NVP 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, G16E, E35D, N37S, R41K, K45KR, L63T, I72T  
>00p19-1| codons 1-99
PQITLWQRPIVTVRVEGQLKEALLDTGADDTVLEDMSLPGKWKPRMIGGIGGFIKVRQYD
QITIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y K219R K103KN, Y181C V108VI, K238KN T27I, V35I, K43Q, V118I, K122E, I135L, S162C, V179VI, E203D, H208F, R211K, D218E, L228LR, V245K, A272P, A288S, I293V P25L
>00p19-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWLLIEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRTKIDELRQFLWKWGFYTPERKHQKEPPFRWMGYELHPDNWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008