<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
18 02p18-1 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 AZT+RTV 22
3 AZT+DDI+RTV 9
4 AZT+RTV 17
5 3TC+AZT+RTV 22
6 3TC+AZT+IDV 135
7 3TC+AZT+IDV 56
8 3TC+AZT+NVP 13
9 3TC+NVP 100

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N Y318F V60VI, K102Q, I135T, S162A, V245K, E312Q  
>02p18-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKQPVHGVFYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   N37NH, I64V, V77I  
>02p18-1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008