<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
17 01p17-3 Unknown 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 None 30
3 3TC+AZT 4
4 AZT+SQV 52
5 AZT+DDC+IDV+SQV 5
6 AZT+SQV 10
7 AZT+NFV+SQV 11
8 AZT+D4T+DDI+NVP+RTV+SQV 11
9 AZT+DDI+NVP+RTV+SQV 30
10 AZT+DDI+NVP+RTV+SQV 46
11 AZT+DDI+NVP+RTV+SQV 36
12 None 16
13 3TC+APV+D4T 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, L210W, T215Y D67S K103N, Y181C   K20R, V35M, T69S, K122KE, I135M, E138Q, S162A, V179I, R211K, K277R, Q278E, T286A, E297K  
>01p17-3| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKSSSKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNQTPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L90M L23I, L33F, F53L, G73S L10I, I13V, I15V, K20R, L63P, H69R, A71V, V77I  
>01p17-3| codons 1-99
PQITLWQRPIVTVKVGGQLREAILDTGADDTVFEEMNLPGRWKPKIIGGIGGLMKVRQYD
QIPIEICGRKVISTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008