<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16 06p16-2 Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 54
2 DDI 11
3 AZT+DDI 36
4 AZT+DDI+NVP 3
5 AZT+NVP 4
6 3TC+AZT+NVP 9
7 3TC+AZT 28
8 3TC+AZT+NVP 11
9 3TC+D4T+NVP 4
10 3TC+D4T+SQV 24
11 3TC+D4T+RTV+SQV 2
12 None 25
13 D4T+DDI+EFV+IDV 9
14 None 10
15 D4T+DDI+IDV 12
16 None 54
17 3TC+AZT+NVP 104
18 DDI+LPV+TDF 240

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F   L10I, T12A, I13V, E35D, M36I, R41K, R57K, H69K, L89I  
>06p16-2| codons 1-99
PQITLWQRPIVAVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPFNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R       E6D, V35T, T39K, K43E, V60I, K122E, D123S, K173I, Q174K, D177E, I178M, T200A, Q207A, R211S, K238R, V245K, K275KR, T286A, E291D, V292I, I293V, E297EK E302A
>06p16-2| codons 1-303
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKALTDIVPLTKEAE
LAL

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008