<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16 02p16-1 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 54
2 DDI 11
3 AZT+DDI 36
4 AZT+DDI+NVP 3
5 AZT+NVP 4
6 3TC+AZT+NVP 9
7 3TC+AZT 28
8 3TC+AZT+NVP 11
9 3TC+D4T+NVP 4
10 3TC+D4T+SQV 24
11 3TC+D4T+RTV+SQV 2
12 None 25
13 D4T+DDI+EFV+IDV 9
14 None 10
15 D4T+DDI+IDV 12
16 None 54
17 3TC+AZT+NVP 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y   K101E, Y181C, G190A   S3CG, E6ED, V35T, T39K, K43E, E44A, K122E, D123S, I135T, E138EQ, S162T, K173I, Q174K, D177E, I178M, V179I, T200A, E203D, Q207AD, R211RK, H221Y, V245E, A272P, T286A, V292I, I293V, E312T, I326V, I329V  
>02p16-1| codons 1-334
PIGPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRIKNPEMII
CQYIDDLYVASDLEIGQHRAKIDELRDHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12A, I13V, E35D, M36I, R41K, R57K, L63LAPV, H69K, K70KR, L89M  
>02p16-1| codons 1-99
PQITLWQRPIVAVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008