<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
15 03p15-3 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 3
2 D4T 124
3 3TC+AZT 13
4 3TC+D4T+SQV 30
5 3TC+D4T+NFV 46
6 D4T+DDI+SQV 21
7 D4T+DDI+EFV 93
8 3TC+APV+D4T 35
9 D4T+DDI+LPV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, Q58E E35D, N37NH, Q61QR, L63P, I64IV  
>03p15-3| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMHLPGRWKPKIIGGIGGFVKVREYD
RIPVEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N   K11R, V35VI, T39A, K64KN, T69N, K102KR, T200I, E203D, Q207H, R211K, D218E, R284K, I293V, E297A, D324E, I329L  
>03p15-3| codons 1-335
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAINKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIDELRHHLLKWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008