<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
15 01p15-2 Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 3
2 D4T 124
3 3TC+AZT 13
4 3TC+D4T+SQV 30
5 3TC+D4T+NFV 46
6 D4T+DDI+SQV 21
7 D4T+DDI+EFV 93
8 3TC+APV+D4T 35
9 D4T+DDI+LPV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10F, Q58QE, G73GA E35D, N37NS, L63P, I64V  
>01p15-2| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVREYD
QIPVEICGHKAIATVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q L100LI, K103N K238KT K11R, T39A, T69TN, E203D, Q207H, R211K, D218E, L228LH, R284K, I293V, E297A, D324E  
>01p15-2| codons 1-324
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRHHLLKWGFTTPEQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKE

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008