<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13 03p13-1 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N K238T V35I, E40D, A98S, D177E, G196R, R211K, V245K, A272P, T286A, V292I, E297T, V314I, Q334E  
>03p13-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIRQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIIPLTTEAE
LELAENREILKEPIHGVYYDPSKDLIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F, Q58E E35D, I62V, L63H T74R
>03p13-1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVFEDMNLPGRWKPKMIGGIGGFIKVREYD
QVHIEICGHKAIGRVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008