<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11 99p11-1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 AZT+DDI 113
3 AZT 17
4 AZT+DDC 30
5 3TC+D4T 4
6 3TC+D4T+IDV 43
7 3TC+D4T+SQV 4
8 D4T+NFV+SQV 52
9 D4T+NFV 1
10 3TC+ABC+EFV+NFV 9
11 3TC+ABC+EFV 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74I, Y115F, M184V D67G, K219Q K103N, V106A F227L T69N, R83K, I202V, K277KR, T286A, E291D L283LF
>99p11-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSNRWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAFFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTPDQKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLFRGAKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, L63P, V77I, I93L  
>99p11-1| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008