<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
10 00p10-2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 AZT+DDC 78
3 AZT+DDI 21
4 3TC+AZT 13
5 3TC+D4T 39
6 3TC+D4T+IDV 5
7 3TC+D4T+SQV 37
8 3TC+D4T+NFV+SQV 2
9 D4T+NFV+SQV 44
10 D4T+NVP+RTV+SQV 14
11 3TC+AZT+IDV 31
12 ABC+D4T+EFV 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   Y188L   K20R, V35I, K43E, E44D, R83K, K102KQ, V106L, V118I, K122E, I135L, S162Y, R211K, K223KT, V245K, A272P, K277R T165Q
>00p10-2| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSLTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQYSMQKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQTEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10LV, I15IV, N37AS, L63HQ, I64V, V77I  
>00p10-2| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008