<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 02p7-2 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 416
2 D4T+DDI+EFV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N   V35T, T39L, K43KR, E44ED, R83RK, V90I, I135T, S162H, E203D, R211KN, V245T, A272P, I293V, E297A, V317G  
>02p7-2| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLELERDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGGYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L   L19I, I62IV, L63LAPV, A71T, I93L  
>02p7-2| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVVIEICGHKTIGTVLVGPTPLNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008