<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 01p7-1 Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 411

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y       V35T, T39L, K43R, E44D, V90VI, K122KE, I135T, S162H, E203D, R211K, H221HY, V245MT, A272P, I293V, E297A, V317G  
>01p7-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLELERDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGGYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L   L19I, L63LP, A71T, I93L  
>01p7-1| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPLNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008