<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6 00p6-2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 57
2 3TC+DDC 57
3 3TC+DDC+IDV 18
4 3TC+D4T+IDV 69
5 3TC+ABC+RTV+SQV 4
6 3TC+NVP+RTV+SQV 13
7 3TC+DDI+RTV 4
8 3TC+DDI+EFV+RTV 22
9 3TC+DDI+EFV+RTV 2
10 DDI+EFV+RTV 30
11 D4T+DDI+EFV+RTV 34
12 3TC+D4T+DDI+LPV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, I15V, R41K, L63P, A71T, I72V P81PL
>00p6-2| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGHKTVGTVLVGPTLANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V V75A, F77L, F116Y K103N, V106VA P225PH V35L, T69NS, K73M, K101KR, K122E, I135V, K173T, T200E, E203EK, R211K, L228LR, V245E, K277R, I293V, E297Q  
>00p6-2| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRMLADLRELNKRTQDFWEVQLGIPHPAGLRKNKSATVLDVGDAYYSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYVDDLYVGSDLEIGQHREKIKELRQHLLKWGFTTPDKKHQKEHPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008