<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6 00p6-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 57
2 3TC+DDC 57
3 3TC+DDC+IDV 18
4 3TC+D4T+IDV 69
5 3TC+ABC+RTV+SQV 4
6 3TC+NVP+RTV+SQV 13
7 3TC+DDI+RTV 4
8 3TC+DDI+EFV+RTV 22
9 3TC+DDI+EFV+RTV 2
10 DDI+EFV+RTV 30
11 D4T+DDI+EFV+RTV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M V75A, F77L, K219E K103N, Y181C, G190A P225H V35L, T69N, K73M, K101R, K122E, I135IV, K173T, T200E, E203K, R211K, V245E, K277R, I293V, E297Q  
>00p6-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRMLADLRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTQNPDIVI
CQYMDDLYVASDLEIGQHREKIKELRQHLLKWGFTTPDEKHQKEHPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, R41K, L63P, A71T, I72V  
>00p6-1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGHKTVGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008