<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 02p5-2 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 100
2 AZT+DDC 9
3 3TC+D4T+NFV 268

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K20KR, E35D, M36MIV, N37D, R41K, L63P, I64V, V77VI  
>02p5-2| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDVDLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K43Q, V60VI, V90VI, K122E, D123S, I135T, T139M, S162Y, I202IV, D250DE, A272P, K277R, E297EK, V317VA, I326IL, Q334E  
>02p5-2| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGAYYDPSKDLLAEIQKQGEG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008