<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 99p5-1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 100
2 AZT+DDC 9
3 3TC+D4T+NFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D E35D, M36MIV, N37D, R41K, L63P, I64V  
>99p5-1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDVDLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K43Q, K122E, D123S, I135T, T139M, S162C, I202V, A272P, K277R  
>99p5-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008