<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 03p2-6 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+DDI 9
3 3TC+AZT 33
4 3TC+AZT+IDV 11
5 AZT+IDV 13
6 D4T+IDV 8
7 AZT+DDI+IDV 31
8 DDI+RTV+SQV 31
9 ABC+D4T+NFV 2
10 ABC+D4T+EFV+NFV 48
11 ABC+EFV+NFV 22
12 None 26
13 APV+DDI+LPV+NVP 15
14 APV+LPV+NVP 9
15 APV+LPV 2
16 3TC+APV+AZT+LPV 48
17 3TC+AZT+LPV 10
18 3TC+IDV+LPV+TDF 8
19 3TC+IDV+TDF 28
20 None 4
21 3TC+ABC+AZT 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, L33F, F53L I13V, K20T, R41K, K55R, R57K, I62V, L63P, A71I, I72V, I93L, C95F  
>03p2-6| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGLVRVKQYD
QVPIEICGHKIVGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y     A98AG E28EK, T39A, E44D, V118I, K122E, I135T, S162C, Q207E, R211RK, L228H, V245E, L283I, I293V  
>03p2-6| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008